Protein Info for MPMX26_00092 in Acinetobacter radioresistens SK82

Annotation: Dye-decolorizing peroxidase YfeX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR01413: Dyp-type peroxidase family" amino acids 4 to 298 (295 residues), 215 bits, see alignment E=8.3e-68 PF04261: Dyp_perox_N" amino acids 32 to 130 (99 residues), 41.8 bits, see alignment E=1.1e-14 PF20628: Dyp_perox_C" amino acids 135 to 297 (163 residues), 177.2 bits, see alignment E=2.4e-56

Best Hits

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 86% identity to abb:ABBFA_003378)

Predicted SEED Role

"Predicted dye-decolorizing peroxidase (DyP), YfeX-like subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX26_00092 Dye-decolorizing peroxidase YfeX (Acinetobacter radioresistens SK82)
MTAQSVILPLPSDHARFISLRLKDLSVAELKEQIALLHSTRDRLITQHPAAQIKAAVAFG
PEIWLQLYKEMPPGFKQLAPQQGTFQMPVVPADVFIHIASARADICFALSQAFFEGIKDK
VEVLDERVCFRYFDGRDITGFIDGTENPQFNDDRAEVALLPEDSGVFADGSFIFAQRYAH
DLEKWKRLKVDTQEQIMGRTKLESIELDDEVKPENAHIARTVVEDENGEEMEILRHSLPY
GDGKGDQGLFFIAYTKDLNIIDLMLNRMFGTSGDGIHDRLLHFVTPLDGAYYFAPSAELL
EVILES