Protein Info for MPMX26_00054 in Acinetobacter radioresistens SK82

Annotation: N(5)-(carboxyethyl)ornithine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF05222: AlaDh_PNT_N" amino acids 11 to 119 (109 residues), 55.4 bits, see alignment E=1.2e-18 PF02826: 2-Hacid_dh_C" amino acids 143 to 230 (88 residues), 27.3 bits, see alignment E=3.3e-10 PF01262: AlaDh_PNT_C" amino acids 182 to 308 (127 residues), 76.5 bits, see alignment E=3e-25

Best Hits

KEGG orthology group: K00298, N5-(carboxyethyl)ornithine synthase [EC: 1.5.1.24] (inferred from 69% identity to wvi:Weevi_0958)

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1 or 1.5.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MPMX26_00054 N(5)-(carboxyethyl)ornithine synthase (Acinetobacter radioresistens SK82)
MKTLGFPISDKLNEKRRALIPSHIERIKKPEKIYIEKGYGEVLGYSDEEYLSCGVNIVNR
QLVLKQDIICDPKIGDATYLDQLYDQTIFGWVHAVQNKDITEKLISKNLTAIAWEDMFEK
GRHVFWRNNEIAGEAAIVHAYTLHGLFPYNTKVALLGRGNIARGALKILTMMGADITVYD
RRTEQLLRDEIGKYDVFVNAILWDTSRKDHIIYKDDLSKMKKGSLIIDISCDRNGGVETS
IPTTLTNPIYVVDNIVHYAVDHTPTLFFKTISESLSENIAPYLNQLIDDTPDIVLKNAIA
VQDGIIVDQRINQFQGR