Protein Info for MPMX26_00028 in Acinetobacter radioresistens SK82

Annotation: Putative aliphatic sulfonates-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 46 to 317 (272 residues), 237 bits, see alignment E=1.3e-74 PF04069: OpuAC" amino acids 59 to 250 (192 residues), 40.2 bits, see alignment E=8e-14 PF09084: NMT1" amino acids 61 to 256 (196 residues), 59 bits, see alignment E=1.6e-19 PF12974: Phosphonate-bd" amino acids 79 to 200 (122 residues), 30.1 bits, see alignment E=7.9e-11 PF16868: NMT1_3" amino acids 98 to 207 (110 residues), 32.8 bits, see alignment E=1.5e-11 PF13379: NMT1_2" amino acids 132 to 254 (123 residues), 46 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 71% identity to abb:ABBFA_003481)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>MPMX26_00028 Putative aliphatic sulfonates-binding protein (Acinetobacter radioresistens SK82)
MNSQQISWARSAILLTSLATALFLGGCSKSDPQTQVLNIGFQKYGILPILKVQGSLENAL
KSQGIKIRWVEFPAGPQLLEGLNVGSVAFGEAGEAPPIFAQAANSNIVYVANQPGAPHGE
ALVVQKNSPIQSVADLKGKRIALNKGSNVHYLLLNILEANDLKLEDIQVVYLPPADARAA
FERGSVDAWVIWDPFLAAAEQQLGARVLKDGQGLVNNLQFYLADRKFAESNPKVIQTIIQ
ELNTTTQWVAQHQDEAASLLEQPTGLEHNILKTSISRMGFGVRPVSQEVSHAQQKVADAF
YAQKLIPVKLDIQAAILKQTP