Protein Info for MPMX26_00012 in Acinetobacter radioresistens SK82

Annotation: Epoxide hydrolase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF12146: Hydrolase_4" amino acids 31 to 241 (211 residues), 56.2 bits, see alignment E=4.8e-19 PF00561: Abhydrolase_1" amino acids 31 to 263 (233 residues), 81.2 bits, see alignment E=1.5e-26 PF12697: Abhydrolase_6" amino acids 32 to 271 (240 residues), 69.1 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: None (inferred from 46% identity to asd:AS9A_4014)

Predicted SEED Role

"Epoxide hydrolase (EC 3.3.2.9)" (EC 3.3.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>MPMX26_00012 Epoxide hydrolase A (Acinetobacter radioresistens SK82)
MIDLSKQRLERYHRGELSFDLIDSGPLEGEAVVLLHGFPETAQCWDQVRVQLNAAGFRTF
APNQRGYSLDARPEGRQAYRMQELLQDLDLLIDQINQPVHLVGHDWGAIVAWEYAMHYPK
KLKNLVVLSVPHPGAFLRALLASDQLFKSYYIGLFQLPKLPELLFEKFPKIGLGLLKNSG
MTKQQLEIFKTEMLEQGRLSYSLNWYRALPFNARFQRFDPVTIPTLFIGGTQDVAISDAG
VKLNQRYVQAPYREVILEANHWLPVQQAAVVSQLILEQIQA