Protein Info for MPMX26_00001 in Acinetobacter radioresistens SK82

Annotation: Chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF11638: DnaA_N" amino acids 2 to 60 (59 residues), 43.2 bits, see alignment E=6.4e-15 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 3 to 457 (455 residues), 512 bits, see alignment E=7.9e-158 PF00308: Bac_DnaA" amino acids 124 to 285 (162 residues), 203.8 bits, see alignment E=5.1e-64 PF01695: IstB_IS21" amino acids 159 to 262 (104 residues), 34 bits, see alignment E=5.6e-12 PF00004: AAA" amino acids 162 to 279 (118 residues), 35.7 bits, see alignment E=2.8e-12 PF08299: Bac_DnaA_C" amino acids 369 to 437 (69 residues), 97.6 bits, see alignment E=8.5e-32

Best Hits

Swiss-Prot: 91% identical to DNAA_ACIAD: Chromosomal replication initiator protein DnaA (dnaA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 91% identity to aci:ACIAD0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>MPMX26_00001 Chromosomal replication initiator protein DnaA (Acinetobacter radioresistens SK82)
MLWTDCLTRLRQELSDNIFAMWIRPLVAEELEDTLRLYAPNPYWTRYIQEHHLELITILA
EQMSEGRVRKVEILVDSRPGAILSAAEQPATTTAALEHPASMPVSRPKKEKEAEPAKQNK
KRLLNPLFTFALFVEGRSNQMAAETCRKVLTQLGASQHNPLFLYGPTGLGKTHLMQAVGN
ALLQAKPNARVMYMTAESFVQDFVSSLQRGKVEEFKKNCRSLDLLLVDDIHLLAGKEASL
VEFFYTFNALLDESKQIILTSDRYPKELTELDPRLVSRFSWGLSVGVEPPDIETRIEILL
KKAESNEIDLPRNCALFIAQQVVANVRELEGALNKVVAISRFKGTAIDLDVVRESLKDVL
AIRARTISVENIQRVVSEYFRIPLKELVGPKRTRIYARPRQLAMGLARELTGDSFPEIGM
AFGGRDHSTVMHACEKVQSLRAEDPIFNEDYKNLLRLLQS