Protein Info for MPMX19_06974 in Azospirillum sp. SherDot2

Annotation: 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF23441: SDR
  • amino acids 5 to 247 (243 residues), 41.4 bits, E=2.3e-14
• PF00106: adh_short
  • amino acids 8 to 193 (186 residues), 187.6 bits, E=3.7e-59
• PF08659: KR
  • amino acids 10 to 164 (155 residues), 35.3 bits, E=2.4e-12
• PF13561: adh_short_C2
  • amino acids 14 to 247 (234 residues), 211.4 bits, E=3e-66

Best Hits

Swiss-Prot: 46% identical to TSAC_COMTE: 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 (tsaC1) from Comamonas testosteroni

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 61% identity to xau:Xaut_1358)

MetaCyc: 46% identical to 4-sulfobenzyl alcohol dehydrogenase subunit (Comamonas testosteroni T-2)
1.1.1.M5 [EC: 1.1.1.M5]; 4-(hydroxymethyl)benzenesulfonate dehydrogenase. [EC: 1.1.1.M5, 1.1.1.257]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• 4-toluenecarboxylate degradation (1/3 steps found)
• biotin biosynthesis I (9/15 steps found)
• 4-toluenesulfonate degradation I (1/4 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.257 or 1.1.1.M5

Protein Sequence (250 amino acids)

>MPMX19_06974 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 (Azospirillum sp. SherDot2)
MTKRLDGKVALITGAAQGLGLAMAETFVREGARVAVVDINGDAAHAVAERLGEAAIGIKA
NVTSTADVEMTIAATVEKFGRLDILVNNAGSTHANGPFENVTEEEFDRVFALNVKSIYLY
SKAVVATMRAQKSGVILNLGSTAGLRPRPGLVWYNATKGAVHNITQSLALELAPDNIRVC
ALAPVATETPLLATFMGGDTPEKRARMLGIVPLGRLGQPSDVANAALYLASDEAAFITGV
VLEVDGGRCV