Protein Info for MPMX19_06971 in Azospirillum sp. SherDot2

Annotation: Macrolide export ATP-binding/permease protein MacB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 276 to 302 (27 residues), see Phobius details amino acids 322 to 353 (32 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details PF12704: MacB_PCD" amino acids 29 to 242 (214 residues), 115.5 bits, see alignment E=4.4e-37 PF02687: FtsX" amino acids 280 to 393 (114 residues), 60.8 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 88% identity to azl:AZL_c03450)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>MPMX19_06971 Macrolide export ATP-binding/permease protein MacB (Azospirillum sp. SherDot2)
MDDGESGGRRWRALAADALRNLGAMRQRSLLALLGIAIGTAAVVALISIGENAREHSMRQ
FLAMGADILTVQKDFSLSGRPAALTRADVDRLRALPGVEEVAPLAMLGVEIRQGRTRLPS
AVTGVTPEFFALVQAKAAQGRTLAEGDRTATVVVLGAGLARRLAEDGHPPVPGSLLRMGG
YNHTVVGVLAGSTPNPVLPLDVDSTAFVPLSGARRVSANSDITNLVVRKMSVAADQDVRQ
SMTGHFSGGAHPRPVMVQSARQLIVAMSDQARVHTLLLAAIGGVSLIVGGVGVMNVMLMG
VVERRREIGLRMALGARPIDVCAMFLAEALALSLSGGMAGALLGLAAAAVYAWNAGWAFA
PSVPSLPLGLGMSSGVGLFFGLYPAMQASRLEPVAALRGE