Protein Info for MPMX19_06946 in Azospirillum sp. SherDot2

Annotation: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 34 to 145 (112 residues), 62.6 bits, E=7.3e-21
• PF12697: Abhydrolase_6
  • amino acids 35 to 270 (236 residues), 56.3 bits, E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 66% identity to axy:AXYL_03189)

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Protein Sequence (282 amino acids)

>MPMX19_06946 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase (Azospirillum sp. SherDot2)
MRATIESITGRYMRLDYKGREHRIYFEEAGQGIPLVCLHTAGSDGRQFRGILNDPRITRD
FRVIAFDLPWHGKSSPPAGWQDGDYQLTSADYTDIILTVCRALELDRPVAMGCSIGGRIA
LHLAMEHAEEFRAIIGLQSSAHVHPYYDTTWLHHPDVHGGEVCAAIAAGLVGPNAPDAHR
WETVWHYMQGGPGIFKGDLYFYKVDGDIRHRLSEIDTSRCPLYLLTGEYDYSCSPADTLE
TAACIPGATVSIMPGLGHFPMSEDPEGFVAHLLPVLSEIAHR