Protein Info for MPMX19_06906 in Azospirillum sp. SherDot2

Annotation: Acetyl-CoA:oxalate CoA-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF02515: CoA_transf_3" amino acids 19 to 383 (365 residues), 402.1 bits, see alignment E=1.3e-124

Best Hits

Swiss-Prot: 42% identical to ACOCT_ACEAC: Acetyl-CoA:oxalate CoA-transferase (uctC) from Acetobacter aceti

KEGG orthology group: None (inferred from 53% identity to bpt:Bpet3292)

MetaCyc: 38% identical to acetyl-CoA:oxalate CoA-transferase (Escherichia coli K-12 substr. MG1655)
RXN0-7075 [EC: 2.8.3.19]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>MPMX19_06906 Acetyl-CoA:oxalate CoA-transferase (Azospirillum sp. SherDot2)
MTVFDGGAAPDAARSPGPLHGIRVLDLSRVLAGPWCTQCLADLGAQVLKIESPGDGDETR
SWGPPYMGDLAAYYTCANRSKHSLTVDLKSAEGQRLIRDLAAEADILIENFKLGTLDRFG
LGYDDLKPVNPALIYCSVSGYGRTGPEAARAGYDFVIQGETGLMSVTGFPDGPPTKVGVA
VSDLFSGLYASQAILAALLGRQRTGRGQFLDVALFDCQLAAMANVAAGALATGAESRRYG
NAHPNVVPYEVFETSDGPFVLAIGNDRQFRTLCESVLEDIAMRDDPAFRTNADRVANRVL
LSQRLAARFRERPRAHWMERLAARSLPAGAVRSVVQALASDQVAGRNLLHSFETASGGPI
RVVGYPVKFEDGLPPPGRPPAQGEGGGEIAKQWLGRRSGAGRTP