Protein Info for MPMX19_06898 in Azospirillum sp. SherDot2

Annotation: FAD-dependent urate hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 50 to 265 (216 residues), 32.3 bits, see alignment E=2.6e-11 PF01494: FAD_binding_3" amino acids 50 to 197 (148 residues), 25.4 bits, see alignment E=2.9e-09 PF13454: NAD_binding_9" amino acids 52 to 194 (143 residues), 39.2 bits, see alignment E=2.6e-13 PF13738: Pyr_redox_3" amino acids 53 to 267 (215 residues), 43.4 bits, see alignment E=9.2e-15 PF13450: NAD_binding_8" amino acids 53 to 82 (30 residues), 22.3 bits, see alignment (E = 4.5e-08) PF13434: Lys_Orn_oxgnase" amino acids 132 to 357 (226 residues), 29.3 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to azl:AZL_a01360)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>MPMX19_06898 FAD-dependent urate hydroxylase (Azospirillum sp. SherDot2)
MTKDNSAVPSTVADPGPRSLEELEARLARDLDLLTLPPADWVPARDAVLDVAIVGAGMAG
LTAAFALRKVGISNIRLFDRAPAGREGPWGTYARMETLRSPKTLTGPALGFANLTFRAWF
EAQFGRTAWDALFRIPRLQWLEYLTWYRRVTGAPVRNDTALTAISGDADGVTLNLDSPEG
RQRVRARRVILANGRDGLGGPFVPAFWKAVDKRFWSHAHEPIDFDGLKGRTVAVLGAGAG
AVDNAAEALERGAAKVYMLIRRAELPRINKSLGAGHPGIVLGFHTLSDERRWAYNQYIAD
TGVPAPHNSMLRCSRHPNFSLLTGCAVEAAAAEGGRLVLRTGRGTVTVDHVILATGFALN
WEQRPELAEIARHTLLWRDRYVLPGHEAGEFAQHPYLGADFEFLERTPGEAPWLNRIHAF
NYAAVLSHGKVTGDIPGISAGAERLADSITAALFTEDYDYHWQRLIGFETPELLGDEWTE
AEDFR