Protein Info for MPMX19_06832 in Azospirillum sp. SherDot2

Annotation: L-cystine transport system permease protein YecS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 84 to 93 (10 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details TIGR03004: ectoine/hydroxyectoine ABC transporter, permease protein EhuC" amino acids 5 to 216 (212 residues), 305.6 bits, see alignment E=2.2e-95 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 9 to 105 (97 residues), 86.9 bits, see alignment E=1.1e-28 PF00528: BPD_transp_1" amino acids 30 to 211 (182 residues), 77.3 bits, see alignment E=6.4e-26

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 77% identity to mlo:mlr7135)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>MPMX19_06832 L-cystine transport system permease protein YecS (Azospirillum sp. SherDot2)
MADWAGYLGLMLEGALVTAKLTVLGCALALPAAFLAGLGRLSRYSTVRAVSVAYIEFFRG
TSIFVQLFWAYFVLPLIGVTLTPLQAGVLALGLNVGAYGAEVVRAAVQSIGREQHEACVA
LNLTRWQSLRHVLLPQAAVVMVPTFCNNAIELLKATSVVSLISLSDLTFQAQVVRSQTGS
TALPFLTVLVIYFAYASLISAGMKALERRMTRGLDGLRT