Protein Info for MPMX19_06830 in Azospirillum sp. SherDot2

Annotation: Maleate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR02990: ectoine utilization protein EutA" amino acids 16 to 253 (238 residues), 405.4 bits, see alignment E=3.8e-126 PF17645: Amdase" amino acids 80 to 250 (171 residues), 86.8 bits, see alignment E=1.8e-28

Best Hits

KEGG orthology group: K01799, maleate isomerase [EC: 5.2.1.1] (inferred from 69% identity to mlo:mlr7137)

Predicted SEED Role

"Arylmalonate decarboxylase (EC 4.1.1.76)" (EC 4.1.1.76)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.1

Use Curated BLAST to search for 4.1.1.76 or 5.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>MPMX19_06830 Maleate isomerase (Azospirillum sp. SherDot2)
MPSLPILRSPTALDFDDRPVEKRVGLVVLATDHTTEPDFRRMVASDRIGIYTARIAYANP
TTPENLRRMQPRLAEGAALILPDEPLAAICYSCTSASVVMGDDAIEQAIASAKPGVPVIT
PPAAARHGLTAFGAQRIAVLTPYTEQTSRPMAAYFGVHGFDIARFTCFGLDDDREMARIA
PASLVRAAVEAMPPDADALFISCTALRSAGVAAEIEDAIGRPVVTSNQATAWATLRLCGD
DRPRPEGGRLMTLPLPQDAWS