Protein Info for MPMX19_06817 in Azospirillum sp. SherDot2

Annotation: Glycine betaine/choline transport system permease protein OusW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 140 to 166 (27 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 272 (162 residues), 79.7 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 74% identity to atu:Atu5219)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>MPMX19_06817 Glycine betaine/choline transport system permease protein OusW (Azospirillum sp. SherDot2)
MLDANDLNVFPVDAWIQDGVAWIALNLRPLFLAIKWPVEYVLNLNIFLLQEIPFLAIVAV
AVLLAWRLASLGVACFSAVALVAIAALGVWSEAMTTLSLITTAIVICAAIGIPIGIGCAR
SDRMWGVVRPILDIMQTTPTFVYLVPVVMLFGVGTVPGEVAVVTAAAPPLIRFTNLGIRM
VETEMVEAGLAFGATKRQLLWEVQLPLAVPTILGGLNQTVLTAMVMSVVVAMIGAEGLGL
VVLQGLGRLDVGRAAVGGIAIVLLAMMLDRITQKMAQPGGPGGRPLLRSLRALVRSGRPA
DGKTAAGPATSKPAISSPDQ