Protein Info for MPMX19_06712 in Azospirillum sp. SherDot2

Annotation: UDP-N-acetyl-D-glucosamine 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 28 to 203 (176 residues), 147.7 bits, E=7.4e-47
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 28 to 439 (412 residues), 419.6 bits, E=5.9e-130
• PF03446: NAD_binding_2
  • amino acids 28 to 157 (130 residues), 34.3 bits, E=5.8e-12
• PF02737: 3HCDH_N
  • amino acids 29 to 109 (81 residues), 27.1 bits, E=9.2e-10
• PF00984: UDPG_MGDP_dh
  • amino acids 224 to 315 (92 residues), 107.5 bits, E=7.6e-35
• PF03720: UDPG_MGDP_dh_C
  • amino acids 344 to 441 (98 residues), 73.5 bits, E=4.2e-24

Best Hits

Swiss-Prot: 57% identical to UGND_PSEAE: UDP-N-acetyl-D-glucosamine 6-dehydrogenase (wbpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13015, UDP-N-acetyl-D-glucosamine dehydrogenase [EC: 1.1.1.-] (inferred from 93% identity to azl:AZL_f01240)

MetaCyc: 57% identical to UDP-N-acetyl-D-glucosamine 6-dehydrogenase monomer (Pseudomonas aeruginosa PAO1)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-α-D-xylose biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-N-acetyl-α-D-galactosaminuronate biosynthesis (1/2 steps found)
• UDP-sugars interconversion (4/9 steps found)
• UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (1/5 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Starch and sucrose metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.136 or 1.1.1.22

Protein Sequence (454 amino acids)

>MPMX19_06712 UDP-N-acetyl-D-glucosamine 6-dehydrogenase (Azospirillum sp. SherDot2)
MSTADTQPDMQAPDIQSLESAYRGRSARVAVVGLGYVGLPLALALTGAGFTVTGFDIDPA
KAAALNGGRSYIRQIADGRVAQAAATGRFRATTDADAFAACDAVIVCVPTPLSPQREPDL
SFVEASTRLIRDRLRRGQLVILESTTWPGTTDEVMRPILEETGLASGRDFFLAYSPERED
PGNITFTTSTIPKVVGGDDEGARRLAVALYEQVVPQVVPVSGTRAAEATKLTENIFRSVN
IALVNELKIVFEPMGIDIWEVIEAAKTKPFGFMPFYPGPGLGGHCIPIDPFYLTWKAREY
QISTRFIELAGEVNTMMPRHVVDRLALALDRQAGIGLSRSRILLVGMAYKKNVDDSRESP
GLRLMEMLLERGAAVEYHDPFIPVLPVTREHSALAGRRSVEWTAERLAGFDAAVIVTDHD
GIDWQGLAAHCPLVVDTRNAMRAVEGFADRIVKA