Protein Info for MPMX19_06708 in Azospirillum sp. SherDot2

Annotation: Translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR00168: translation initiation factor IF-3" amino acids 2 to 154 (153 residues), 216.8 bits, see alignment E=7e-69 PF05198: IF3_N" amino acids 2 to 62 (61 residues), 96.5 bits, see alignment E=8.4e-32 PF00707: IF3_C" amino acids 69 to 153 (85 residues), 129 bits, see alignment E=5.2e-42

Best Hits

Swiss-Prot: 66% identical to IF3_PHEZH: Translation initiation factor IF-3 (infC) from Phenylobacterium zucineum (strain HLK1)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 99% identity to azl:AZL_f01260)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>MPMX19_06708 Translation initiation factor IF-3 (Azospirillum sp. SherDot2)
MVRLVGADGEMVGVVPLRQALEAAADADLDLVEVAPQADPPVCKILDYGKFRFEEQKKAN
EARKKQKIIELKEIKLRPNIDDHDYDVKMRSAIRFIEEGDKVKMTMRFRGREMAHQDLGL
NVLVRVRDQLQDIAKVEQMPRVEGRMMVMVLAPR