Protein Info for MPMX19_06692 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 TIGR00229: PAS domain S-box protein" amino acids 41 to 156 (116 residues), 44.1 bits, see alignment E=2.1e-15 amino acids 153 to 282 (130 residues), 46.3 bits, see alignment E=4.3e-16 PF13188: PAS_8" amino acids 42 to 90 (49 residues), 21.8 bits, see alignment 3.4e-08 amino acids 159 to 207 (49 residues), 20.1 bits, see alignment 1.2e-07 PF08448: PAS_4" amino acids 51 to 150 (100 residues), 26.3 bits, see alignment E=1.9e-09 amino acids 162 to 279 (118 residues), 37 bits, see alignment E=9e-13 PF13426: PAS_9" amino acids 58 to 149 (92 residues), 21.6 bits, see alignment E=5.4e-08 amino acids 168 to 276 (109 residues), 51.3 bits, see alignment E=3.1e-17 PF00989: PAS" amino acids 158 to 269 (112 residues), 51.6 bits, see alignment E=2.2e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 404 to 563 (160 residues), 155.7 bits, see alignment E=9.4e-50 PF00990: GGDEF" amino acids 408 to 561 (154 residues), 149.1 bits, see alignment E=2.4e-47

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>MPMX19_06692 hypothetical protein (Azospirillum sp. SherDot2)
MAEQGERDMDGGAAADPRPGAFPLWPGDGSACGMDGAGVLDALFSTNAAPILLIDPGRDG
AIVDANPRAAVFYGHSRDRLRSLHVWDINQLGRAILPAMREIASWEGGHYPQRFHHRLAD
GSVRDVQVYAGPIHLGGRKLLLCIIHDISAVIEAEQFNRLLLENVQVGVCGIDRSGAVTF
VNPTATRAFGFRHESELIRSHIGRFLFRDSLRSGPDEGGRSHPVFRVAEAGEPARDIETV
LYRGDGTSFPVRLTASPIRNNDGIVGVVISFFDLTEEREREAQASDLANALPGAVFQAEL
HPGGGLRATYFSTAAASLFGVQPDADLTAARTLAPVMALKGWARVRRGLRQAGRAGRVWE
GEMEIAGGRWVLGRAQPRRRHDGTVLFNGVLLDITDRKGLEAELQQAAMHDPLTGVWNRR
RFQQAVGEAAARLERYGRPYILALMDIDHFKRFNDTHGHQAGDDALRVVAATLSDRLRRS
DALARWGGEEFALLLTETDLPSALGVLEALRQRVSAQRMACGGSVTISIGVGQARAGEDI
DSLLQRVDAALYKAKAAGRNRVEQA