Protein Info for MPMX19_06656 in Azospirillum sp. SherDot2

Annotation: Dodecaprenyl-phosphate galacturonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 37% identical to ARNC_PSEPF: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 66% identity to rru:Rru_A1005)

Predicted SEED Role

"Glycosyl transferase, family 2"

MetaCyc Pathways

protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
protein O-mannosylation III (mammals, core M3) (1/5 steps found)
protein O-mannosylation I (yeast) (1/8 steps found)
protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
protein N-glycosylation initial phase (eukaryotic) (1/19 steps found)

KEGG Metabolic Maps

N-Glycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>MPMX19_06656 Dodecaprenyl-phosphate galacturonate synthase (Azospirillum sp. SherDot2)
MTLLLAPGSATTDTGTVSVSVLIPVYNEEDNIAPLCGRLIPALDGLGRSFEVIFVNDGST
DGTEAELQRVASDSRIRVINFRRNVGQTAAMMAGIDHARGDVIVPMDGDLQNDPQDIAGL
LTKLDEGYDVVSGWRADRQDGFLLRTLPSRMANKLISTISGVKLNDYGCTLKAYRRQMLQ
GYRLYGEMHRFVPIYARWQGARLTEMPVRHHPRRHGQSKYGLERVLKVVLDLVVVKFLTQ
YETKPIYIFGFAGLMFMGLSVLAGIYAIYLKLVDGISFILTPLPLLVTMGLVTGVMCILM
GLLAELLVRIYFESQGKSHYSIKTMLNFDEPPPPDRSLRD