Protein Info for MPMX19_06645 in Azospirillum sp. SherDot2

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 14 to 253 (240 residues), 178.7 bits, E=1.4e-56
• PF16363: GDP_Man_Dehyd
  • amino acids 15 to 317 (303 residues), 325.8 bits, E=4e-101

Best Hits

Swiss-Prot: 43% identical to GM4D_PSEAE: GDP-mannose 4,6-dehydratase (gmd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 74% identity to azl:AZL_f01050)

MetaCyc: 43% identical to GDP-D-mannose 4,6-dehydratase subunit (Pseudomonas aeruginosa)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
• GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
• GDP-D-perosamine biosynthesis (1/2 steps found)
• GDP-D-rhamnose biosynthesis (1/2 steps found)
• GDP-L-colitose biosynthesis (3/5 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-mycosamine biosynthesis (1/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.47

Use Curated BLAST to search for 4.2.1.47

Protein Sequence (331 amino acids)

>MPMX19_06645 GDP-mannose 4,6-dehydratase (Azospirillum sp. SherDot2)
MTIGGVTRSESKTALIFGVSGQDGAYLSQLLLDKGYAVHGTSRDREMAGFANLRRLGIFG
RVILHSSVLTDFRSVVEVIARVRPAEIYNLASQASVGLSFDQPVETLNSTISSTINILEA
IRFLKLDTRFYSACSSECFGNTEAPADESTPFHPRSPYGVGKAAAFWAVANYREAYGLFA
CSGILFNHESPLRPTRYVTQKIIRGAADIAEGKTDVLELGTLSIARDWGWAPEYVDAMAR
MLALDDPHDFVIATGEANRLEEFVAQAFSYFGLDWRRHVGGNPDLLRPSDIAFSVGNSAK
AERMLGWRAERRMAQVVTGLADAEMARRSVA