Protein Info for MPMX19_06522 in Azospirillum sp. SherDot2

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 91 to 141 (51 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 74 to 240 (167 residues), 77.7 bits, see alignment E=5e-26

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 98% identity to azl:AZL_a01110)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>MPMX19_06522 Putative aliphatic sulfonates transport permease protein SsuC (Azospirillum sp. SherDot2)
MRTRLYGWAAFPALLLVWSAAAWNLPPYVLPQPWAVAAEALRWLDSGQLAAHVGTSLLRE
AGGFAVAVLGALALGLAGALSPGFRAFSAPLTGLFMAIPPIAWAPLSMIFFGLGYVAITM
VIVVAALFPMAVTVQEGFLAIRNGNLRAARVLGARRWQLIRHVYLPASLPFLTAALRIGF
SQAWRALVAAEMLGASQGIGWMVAMGGQIGNATQVLLGVAIIGMTAWITESLVFRRIERR
YRHWHLA