Protein Info for MPMX19_06429 in Azospirillum sp. SherDot2

Annotation: HTH-type transcriptional regulator HmrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF13411: MerR_1" amino acids 1 to 66 (66 residues), 60.5 bits, see alignment E=2.1e-20 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 126 (126 residues), 168.1 bits, see alignment E=4.6e-54 PF00376: MerR" amino acids 2 to 39 (38 residues), 53 bits, see alignment E=3.6e-18 PF09278: MerR-DNA-bind" amino acids 46 to 108 (63 residues), 71 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 60% identical to HMRR_SINMW: HTH-type transcriptional regulator HmrR (hmrR) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: None (inferred from 79% identity to azl:AZL_a03860)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>MPMX19_06429 HTH-type transcriptional regulator HmrR (Azospirillum sp. SherDot2)
MNIGQASKASGVGAKLIRYYESIGLIPEAGRTASGYRVYTAQEVNVLRFIKRARTLGFSI
ERIQHLVGLWGDKERASSEVKRIALDHVAELEAKIAEMRAMADTLHELAEACHGDQRPDC
SILRDLEKSGLACSGVQRTLEPAADGG