Protein Info for MPMX19_06384 in Azospirillum sp. SherDot2

Annotation: Cadmium, cobalt and zinc/H(+)-K(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 45 to 317 (273 residues), 255.8 bits, see alignment E=2.4e-80 PF01545: Cation_efflux" amino acids 49 to 234 (186 residues), 141.3 bits, see alignment E=1.7e-45

Best Hits

Swiss-Prot: 33% identical to CZCD_BACSU: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus subtilis (strain 168)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 67% identity to azl:AZL_012620)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>MPMX19_06384 Cadmium, cobalt and zinc/H(+)-K(+) antiporter (Azospirillum sp. SherDot2)
MPHDHDDANWHDKAQGHTHNHGHDRHAGHSHGLGGHHNAPASYDRAFAIGAVLNIGFVVI
EAFYGIVANSVALLADAGHNLSDVLGLLLAWGAAWLTRRRPTHRHTYGFGSSSILASLLN
AVVLLIAVGAIAWEAVGRLTHPEPVEGGIVMWVAAVGIVINAVTAWLFMGGKDADLNVKG
AYLHMAADAAVSLGVVVAALLIGWTGWLWLDPLVSLAIVAVIVVGTWGLLRESANLALDA
VPEGVSRADVEAYLTGLPSVAAVHDLHIWGLSTTDTALTAHLVRPDAGTDDAFLKEVAHD
LKERFGIGHVTIQVEHDGGSCLLAPTDVV