Protein Info for MPMX19_06373 in Azospirillum sp. SherDot2

Annotation: Lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 68 to 90 (23 residues), see Phobius details amino acids 98 to 112 (15 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 12 to 152 (141 residues), 90.3 bits, see alignment E=6.4e-30 PF01252: Peptidase_A8" amino acids 17 to 152 (136 residues), 107.2 bits, see alignment E=4.3e-35

Best Hits

Swiss-Prot: 37% identical to LSPA_NITHX: Lipoprotein signal peptidase (lspA) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 48% identity to mes:Meso_4211)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.36

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>MPMX19_06373 Lipoprotein signal peptidase (Azospirillum sp. SherDot2)
MAFRWCPAGLYIAMAMAVIAVVADQVSKWAMLTHILTPADVIQITPFFNLRLGFNTGVSF
GLFSGHMALPPFVLAGFALSMALVLLGWGARLPDRPSVLAAGAMAGGAIGNAVDRIRQGA
VTDFLDLHAFGWHWPTFNLADILIVGGAVVIAFRPSPRVVPS