Protein Info for MPMX19_06345 in Azospirillum sp. SherDot2

Annotation: Pyruvate synthase subunit PorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR02175: 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family" amino acids 1 to 182 (182 residues), 189.3 bits, see alignment E=2.6e-60 PF01558: POR" amino acids 10 to 181 (172 residues), 134.4 bits, see alignment E=2.5e-43

Best Hits

KEGG orthology group: K00172, pyruvate ferredoxin oxidoreductase, gamma subunit [EC: 1.2.7.1] (inferred from 64% identity to app:CAP2UW1_2510)

Predicted SEED Role

"Pyruvate:ferredoxin oxidoreductase, gamma subunit (EC 1.2.7.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.1

Use Curated BLAST to search for 1.2.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>MPMX19_06345 Pyruvate synthase subunit PorC (Azospirillum sp. SherDot2)
MFQVRIHGRGGQGAVTAAEMLSVAAFKEARHAQAFPSFGSERTGAPVVSFCRIADTEIRT
REPVSVPDGLIVLDPTLFHTVDIFQGLPETGYVLINSSRTFEELHIADFMKRFPPGHTHC
VPATELARQHVGRPLPNAALLGGFAAITGQIRIESVLAAIRETFPGAVGEANAKAAVAAY
EHCLA