Protein Info for MPMX19_06333 in Azospirillum sp. SherDot2

Annotation: Regulatory protein AtoC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 83.9 bits, see alignment E=1.8e-27 PF14532: Sigma54_activ_2" amino acids 134 to 304 (171 residues), 71.6 bits, see alignment E=1.7e-23 PF00158: Sigma54_activat" amino acids 134 to 299 (166 residues), 217 bits, see alignment E=2.8e-68 PF02954: HTH_8" amino acids 398 to 436 (39 residues), 45.4 bits, see alignment 1.1e-15

Best Hits

KEGG orthology group: None (inferred from 55% identity to sno:Snov_1290)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>MPMX19_06333 Regulatory protein AtoC (Azospirillum sp. SherDot2)
MRPREAPLVAIIEDDPIMGESLVERLALEGYKPVWWTSGAEAQAALTAHRPDILVCDIRL
PDMNGEELFRTTAAQLGGTPVLFMTGFGDVRQAVRLVKAGADDYLTKPFPIDEFLARVSE
LLQARGRWAGGGVLGTSPRMHQVEQLVRRVADVDSTVLISGESGAGKEVVARYLHESSRH
AQAPFMAVNCAAVPTELIDSEVFGHERGAFTGAHALHRGYAERAADGVLFLDEVGELPLP
QQAKLLRLVQERVFFRVGGEKPLPFQARLICATNLDLEQRVRDGSFRRDLYYRINVIPIV
VPPLRDRRDDILPLLLTYLRRYADSFGRPAQCLTPQAEATALAHDWPGNVRELRNRIERA
VALSTGAWLGVADLFPEQGVRDSFGDAHDWPHLTAVRDESERSYILATLQRADGQMGKAA
DLLGVGRTTLWEKMRRLGIALEQTE