Protein Info for MPMX19_06279 in Azospirillum sp. SherDot2

Annotation: L-threonine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00288: GHMP_kinases_N
  • amino acids 85 to 153 (69 residues), 52.3 bits, E=5.5e-18
• PF08544: GHMP_kinases_C
  • amino acids 222 to 295 (74 residues), 25.6 bits, E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 56% identity to oan:Oant_0654)

Predicted SEED Role

"Threonine kinase in B12 biosynthesis" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis or Propanediol utilization

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (32/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (30/36 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• aminopropanol phosphate biosynthesis I (2/2 steps found)

Protein Sequence (321 amino acids)

>MPMX19_06279 L-threonine kinase (Azospirillum sp. SherDot2)
MPGDVISRFASVRLGTRGNQQKERGLGRVNGHHGELLQGVFPDDAGRLHRGLVTLPCDIV
SSTAVFRPAPGNLVTVPDDKLKAAEAARLTLDSLGLHDQGGHLTVESTIPVGLGMGSSTA
DVVAAIRAVANAHGAVLAAEEVARLAVRAETASDSIMHGELAVLFAQREGIVLEHLGPAL
PPLEVLSVNTAPSALVDTVKQPPADYDDWEVQAFRPLRGMLRRAIRTGDAALLGRVATAS
ARISQRHLPKPAFEEINAIAASTGALGIQVAHSGTVVGLLFDPRNPATARRVAEAAARLE
AFGLPPAFHFRTDVAEVRHVA