Protein Info for MPMX19_06277 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF18130: ATPgrasp_N" amino acids 21 to 99 (79 residues), 35.1 bits, see alignment E=4.7e-12 PF02786: CPSase_L_D2" amino acids 111 to 306 (196 residues), 39.4 bits, see alignment E=1.5e-13 PF13535: ATP-grasp_4" amino acids 145 to 280 (136 residues), 65.6 bits, see alignment E=1.3e-21 PF02655: ATP-grasp_3" amino acids 145 to 279 (135 residues), 35.8 bits, see alignment E=2.6e-12 PF15632: ATPgrasp_Ter" amino acids 185 to 314 (130 residues), 34.8 bits, see alignment E=3.8e-12 PF18603: LAL_C2" amino acids 320 to 396 (77 residues), 39.8 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 36% identity to smk:Sinme_6732)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.2.1

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>MPMX19_06277 hypothetical protein (Azospirillum sp. SherDot2)
MPRLLLFIESNTSGTGRLFAQTARALGFEPVLISRQPSRYPYVAEDAVRSIEANTADLTV
LRSLVQQLAPSEGVAGITSSSEYYIATAACLAAELGLPGPDADAVAACRNKATQRRRLDE
AGVDRVRHAEVTGAADAVQAAIGIGLPVVLKPVAGSGSVGVRLCATMAEVAAHARALLAD
PTGGALLVEEVVRGDEYSVEIFHDAVIGVTRKHLGALPHFVEMGHDFPAPLATAAADRIA
GFALAATRALGLTWGPLHVELRLGEDGPHMMEVNPRLAGGFIPELVRQATGIDLIRATVE
LAVGQTPDVTPTRQEHAAIRFLTPPDDGLWFATEGLEAARGAPFLRDLRLYRASPLPIAR
RGDFQDRLGHALTSAPTLEGAVAAAELARRAIRFRIAADGTGTLATVA