Protein Info for MPMX19_06183 in Azospirillum sp. SherDot2

Annotation: Phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF02878: PGM_PMM_I" amino acids 4 to 135 (132 residues), 149.3 bits, see alignment E=1.1e-47 TIGR01455: phosphoglucosamine mutase" amino acids 6 to 446 (441 residues), 615.9 bits, see alignment E=1.8e-189 PF02879: PGM_PMM_II" amino acids 159 to 256 (98 residues), 66.1 bits, see alignment E=7.3e-22 PF02880: PGM_PMM_III" amino acids 260 to 368 (109 residues), 119.3 bits, see alignment E=1.9e-38 PF00408: PGM_PMM_IV" amino acids 377 to 442 (66 residues), 63.9 bits, see alignment E=2.3e-21

Best Hits

Swiss-Prot: 74% identical to GLMM_RHOCS: Phosphoglucosamine mutase (glmM) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 94% identity to azl:AZL_e01250)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>MPMX19_06183 Phosphoglucosamine mutase (Azospirillum sp. SherDot2)
MTRHLFGTDGIRGTANIDPMTAETALRVAMATALQFRRGDHRHRVVIGKDTRLSGYLLEP
ALTAGFISMGMDVVLVGPLPTPAVAMLTRSLRADMGVVISASHNPYQDNGIKLFGPDGYK
LSDEVEAAIEARMAQPFAPDLARPADLGRASRMEDATGRYIEYVKNTFPRGLRLDGLKIV
VDCANGAAYKVAPKVLYELGADVIPVGVTPDGTNINKGCGATSTQTLQEQVVAHGAHLGV
ALDGDADRLIMVDEAGRPIDGDQLMTLIATSWARSQTLRGGGVVATVMSNLGMERHLGGL
GLHLARTPVGDRYVVEMMRERGYNVGGEQSGHVVLSDYSTTGDGLIAALQVLAVLIQADG
RSASEVCRVFDPVPQKLTNVRFTAGTKPLEDAVVQQAIREGEARLASSGRLLIRKSGTEP
LIRVMAEGDDAALVDSVVADIAGTIQASAARSLEAAQ