Protein Info for MPMX19_06182 in Azospirillum sp. SherDot2

Annotation: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
  • amino acids 15 to 268 (254 residues), 328.7 bits, E=1e-102
• PF08543: Phos_pyr_kin
  • amino acids 22 to 267 (246 residues), 314.6 bits, E=4.3e-98
• PF00294: PfkB
  • amino acids 114 to 247 (134 residues), 29.2 bits, E=6.2e-11

Best Hits

Swiss-Prot: 48% identical to THID_STRCO: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 97% identity to azl:AZL_e01260)

MetaCyc: 44% identical to bacimethrin diphosphokinase (Clostridium botulinum A str. ATCC 19397)
2.7.6.-

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis I (2/2 steps found)
• hydroxymethylpyrimidine salvage (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• bacimethrin and bacimethrin pyrophosphate biosynthesis (1/4 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Protein Sequence (276 amino acids)

>MPMX19_06182 Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (Azospirillum sp. SherDot2)
MSGSTVNGSTVNGRVLIVAGSDSGGGAGIQADIKAVSALGAYAMTAIAALTAQNTTGVYG
VVPVDPAFVALQMKLVLEDIGADAVKIGMLANAPVIEAVATEYEARAVNVPLVLDPVMIA
KSGHHLLDPDAVLTLRRRLLPLAEVVTPNLPEAEALTDLPIRDLDDMRRAAELMLSFGPK
SVLLKGGHLEDDTLYDLLLTEEGETVFEGRRVHTPHTHGTGCTLSSAIAAGLAQGLNTHD
AVARARRYVETAILTAPGLGHGHGPLNHLHTVREFS