Protein Info for MPMX19_06182 in Azospirillum sp. SherDot2

Annotation: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 15 to 268 (254 residues), 328.7 bits, see alignment E=1e-102 PF08543: Phos_pyr_kin" amino acids 22 to 267 (246 residues), 314.6 bits, see alignment E=4.3e-98 PF00294: PfkB" amino acids 114 to 247 (134 residues), 29.2 bits, see alignment E=6.2e-11

Best Hits

Swiss-Prot: 48% identical to THID_STRCO: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 97% identity to azl:AZL_e01260)

MetaCyc: 44% identical to bacimethrin diphosphokinase (Clostridium botulinum A str. ATCC 19397)
2.7.6.-

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>MPMX19_06182 Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (Azospirillum sp. SherDot2)
MSGSTVNGSTVNGRVLIVAGSDSGGGAGIQADIKAVSALGAYAMTAIAALTAQNTTGVYG
VVPVDPAFVALQMKLVLEDIGADAVKIGMLANAPVIEAVATEYEARAVNVPLVLDPVMIA
KSGHHLLDPDAVLTLRRRLLPLAEVVTPNLPEAEALTDLPIRDLDDMRRAAELMLSFGPK
SVLLKGGHLEDDTLYDLLLTEEGETVFEGRRVHTPHTHGTGCTLSSAIAAGLAQGLNTHD
AVARARRYVETAILTAPGLGHGHGPLNHLHTVREFS