Protein Info for MPMX19_06180 in Azospirillum sp. SherDot2

Annotation: Sensor histidine kinase RegB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 97 to 134 (38 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 314 to 414 (101 residues), 74.4 bits, see alignment E=4.9e-25

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 94% identity to azl:AZL_e01280)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>MPMX19_06180 Sensor histidine kinase RegB (Azospirillum sp. SherDot2)
MRDTTDRKNLFLLVQLRWLAVVGQIVTILIVHSQMGIRLPLLPMAAVIFVLIALNIASLI
QIRRSSDVSNTQLFLELLIDVWALTLQLYLSGGASNPFISLYLLQVALGAVLLEAWSAWA
LVLVATAGFTWLIGTHQPLPLPPAYEGELFSLHIQGMFICFVLAASLLVPFLTQINRNLR
ARDAFLAELRQRSMEEAHIVRMGLLASGAAHELGTPLATLSVIVNDWRRMPSLTSDPDLA
DEMAEMQNQIDRCKTIVSGILMSSGEARGEGTVRTTVKGFLDGLVEDWLSSRSPKRFDYD
NTVGPQERMIADLALKQVLFNVLDNALEASPGWIGVAALRQGDNLVVAVNDGGPGFDPAI
LEELGKPYRSTKKRPGSGLGLFLVVNVLRKLGGTVSAKNRPGGGATVTLTLPLSALSPGG
SDGDD