Protein Info for MPMX19_06175 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 36 to 268 (233 residues), 337.3 bits, see alignment E=1.9e-105 PF00116: COX2" amino acids 181 to 249 (69 residues), 30.3 bits, see alignment E=3.4e-11 PF06481: COX_ARM" amino acids 268 to 313 (46 residues), 66.9 bits, see alignment 1.1e-22

Best Hits

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 92% identity to azl:AZL_e01330)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>MPMX19_06175 hypothetical protein (Azospirillum sp. SherDot2)
MDKLSNVGARLLPLALSPKQTFDTGPALSRYRAIALLPVMAALSGCNLVVLNPAGDVASQ
QGDLVVISTLLMLLIIVPVMALTVLFAWRYRQSNNTARYEPDWDHSTQLELVIWAAPLLI
IICLGAITWVTTHKLDPYRPLDRIAADKPVPAGAKPLDVQVVALDWKWLFVYPEYGIASV
NEMAAPVDRQIRFSLTASTVMNSFYVPALAGMIYTMPGMETKLHAVINEPGTYKGFSSNY
SGAGFSHMRFAFLGLSNQDFDGWVSKVKTAGGSLDRNAYLALEKPSEAVPVQHFGTVDPK
LFNAVVNMCVRPGTMCMSDMAAIDRAGGLNAGGKAAADAILRANTLAGFPDTQATGLCTV
AEAVEAAANSGAVQRPTVTPISASASPAGPQRLANP