Protein Info for MPMX19_06140 in Azospirillum sp. SherDot2

Annotation: Alanine racemase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 12 to 370 (359 residues), 229.8 bits, E=2.4e-72
• PF01168: Ala_racemase_N
  • amino acids 15 to 233 (219 residues), 193.6 bits, E=4.1e-61
• PF00842: Ala_racemase_C
  • amino acids 245 to 369 (125 residues), 128.3 bits, E=1.4e-41

Best Hits

Swiss-Prot: 50% identical to ALR_RHORT: Alanine racemase (alr) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 88% identity to azl:AZL_e01720)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• anaerobic energy metabolism (invertebrates, cytosol) (6/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• L-alanine degradation I (2/2 steps found)
• alanine racemization (1/1 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• D-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.1

Use Curated BLAST to search for 5.1.1.1

Protein Sequence (373 amino acids)

>MPMX19_06140 Alanine racemase, biosynthetic (Azospirillum sp. SherDot2)
MTSDQSLRACAILTVDLGAVVANWTQLRDRVAPAECSAVVKADAYGLGVARVVPALAAAG
CRTFVVAQLEEALAVRRALEPVAPDAQVFSLGGLPPGHEGDFLAERILPVLNHLGDIAAW
RAFASSRGEVLPAVIHIDTGMNRLGLGPDELDELAGHPEWLEGIDVRYWMTHLACADEFD
SPMTGEQLERFRGALARLPRAKASFANSSGIFHGADHHFDLARPGCALYGVNPTPHLPNP
MRGTVRLDARLLQVRNCTAPMTVGYGAAHKVTGPARIATIGVGYADGYLRSLSGKGHVFV
DGVAAPIVGRISMDLITIDVTGLPESVAQAGRMVELIGPSRPVDTVAAEGGTIGYEVLTS
LGRRYHRVYVGGE