Protein Info for MPMX19_06092 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 953 PF01565: FAD_binding_4" amino acids 43 to 178 (136 residues), 107.8 bits, see alignment E=1.7e-34 PF02913: FAD-oxidase_C" amino acids 269 to 516 (248 residues), 204.8 bits, see alignment E=8.7e-64 PF13183: Fer4_8" amino acids 539 to 613 (75 residues), 44.7 bits, see alignment 7e-15 PF12800: Fer4_4" amino acids 540 to 553 (14 residues), 15.1 bits, see alignment (E = 1.1e-05) amino acids 597 to 612 (16 residues), 13.8 bits, see alignment (E = 2.9e-05) PF12838: Fer4_7" amino acids 541 to 613 (73 residues), 39.3 bits, see alignment 3.3e-13 PF13534: Fer4_17" amino acids 542 to 613 (72 residues), 38.8 bits, see alignment 4.9e-13 PF13187: Fer4_9" amino acids 542 to 612 (71 residues), 27.8 bits, see alignment 9.3e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to azl:AZL_e03840)

Predicted SEED Role

"Predicted D-lactate dehydrogenase, Fe-S protein, FAD/FMN-containing" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (953 amino acids)

>MPMX19_06092 hypothetical protein (Azospirillum sp. SherDot2)
MLPAPYDRVLAELQSVIPQARLVTDPLRTLAYGTDASFYRLIPKIVALVETEEEVVRLLR
ITRGHGVPVTFRAAGTSLSGQTVSDSVLVVLGDGWRGCTIGPAAATVTLQPGVIGAEANR
RLAPLGRKIGPDPASIATAKIGGIAANNASGMCCGTAQNSYRTLESMRLVLADGTVLDSA
DPASRSRFRDSHGPLLDRLAALGSRTRADEALATRIRDKFRIKNTTGYSLNALVDYEDPV
DILQHLMIGSEGTLGFISTITLRTVPEHPHKASALLFFPDIAEACRAVALLKAAPVDAAE
LMDRASLRSIQDKPGMPPQIRGFGPEVAAVLVETRAESAAALDANVAEIAAVLAGCVTIG
DTSFTTDAKACEGFWKIRKGLFPAVGAIRQTGTTVIIEDVAFPLPRLADATRELQALFER
HGYREAIIFGHALEGNLHFVFTQAFDTQAEIDRYRRFMDDVAELVVTRYDGSLKAEHGTG
RNMAPFVEMEWGPQAYGLMKEIKDLFDPDGLLNPGVILNGDPQAHLKNLKPLPPADPLVD
TCIECGFCEPTCPSHRFTLSPRQRIVGRRELARLEATGDDAGRLAEIAAAYDYQGIDTCA
ACGLCATACPVGIETGLLIKSMRGERRGAVARKAGALVADHMEGTLSLARTGLRLADFAR
RTVGHGVAEAAARVLSGGGLPSLPRSLPTAATFSPKAETVVTDDDVPTVVYAPSCVSRTM
GPAAGDPQQRPLPEVVESVMRKAGFRILYPEAADGQCCGMPLESKGLIEAADAKADAMLA
ALSKASRGGRYPVVMDTSPCALRLKKRLTDAGLRILDVAEFLGEFALPRLDIAKTAEPVM
LHLTCSTRRMGLDGALTAVAKACAETVVVPPDVGCCGFAGDKGFTTPELNAHALRHLPAT
VPEGCASGYSTSRTCEIGLSDKAGVPYRSIVYLVDACTTAKAEATARVAEPAF