Protein Info for MPMX19_06076 in Azospirillum sp. SherDot2

Annotation: KHG/KDPG aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  • amino acids 14 to 209 (196 residues), 165.1 bits, E=6.7e-53
• PF01081: Aldolase
  • amino acids 16 to 200 (185 residues), 133.6 bits, E=3.2e-43

Best Hits

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 96% identity to azl:AZL_e04020)

Predicted SEED Role

"4-Hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16) / 2-dehydro-3-deoxyphosphogluconate aldolase (EC 4.1.2.14)" in subsystem D-Galacturonate and D-Glucuronate Utilization or Entner-Doudoroff Pathway (EC 4.1.2.14, EC 4.1.3.16)

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• superpathway of hexuronide and hexuronate degradation (9/10 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• D-galacturonate degradation I (5/5 steps found)
• D-fructuronate degradation (4/4 steps found)
• superpathway of β-D-glucuronosides degradation (6/7 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• D-glucosaminate degradation (1/3 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.3.16

Protein Sequence (217 amino acids)

>MPMX19_06076 KHG/KDPG aldolase (Azospirillum sp. SherDot2)
MSTTQTPNEILDQLVAYGVVPVIRNSSADLARTAVTWLREAGYGTFEITMTTPGAVGLIE
ELSAEGGALIGAGTVLTPAAVADVVKAGAKYVVSPCVVPKVAAACRDHGVACLMGALTPT
EVHAAISAGADAIKIFPASTVGPAHIKALKSVFPGVRFVPTGGIDATTVASYVAAGVACV
GAGGKLVDETLVKKGDREGILAAGRQLMEAYRAAKGA