Protein Info for MPMX19_06069 in Azospirillum sp. SherDot2

Annotation: C4-dicarboxylate TRAP transporter large permease protein DctM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 34 (8 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 316 to 344 (29 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 396 to 420 (25 residues), see Phobius details PF06808: DctM" amino acids 7 to 414 (408 residues), 292.1 bits, see alignment E=3.3e-91 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 422 (406 residues), 310 bits, see alignment E=1.1e-96

Best Hits

KEGG orthology group: None (inferred from 84% identity to azl:AZL_e03950)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>MPMX19_06069 C4-dicarboxylate TRAP transporter large permease protein DctM (Azospirillum sp. SherDot2)
MITTLLFGSFLVMMVLGVPIAAALGLAGTAAIAFAHLGVISVPTSVYTGIAKYPLLTIPM
FVLAGTIFDRSGVAQKLVRFATAIVGQGKGALAVIAVVVAMMMGGISGSGPAIAAAVCGV
MAPSMIRAGYPRPYIASVIAAAAATDILIPPSVALIIYSVLVPAAPTTSMFAAGIIPGTL
AGLALIIPVFWLARKYNLGSKLSHEPRPPFWRSLWDASLGLFAKVIILGGLRLGIFTPTE
AAVIAVAYGLLLGMVVYRTIRVRDLYSMLVEAAEISAIILTVIALASVFGWALSTLSVID
PIADAIIHSGLGEYGVMALLVVLLTVVGTFLDGISIFIILLPLLIPIATAYKWDLTWFGV
ILTLMIAVGQFTPPMAVNLMVACRMTGCTMESTLRWVMWPLITMLLVVVAVIVWPELALW
MPRQMGF