Protein Info for MPMX19_06061 in Azospirillum sp. SherDot2

Annotation: Solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF03480: DctP" amino acids 49 to 322 (274 residues), 254.3 bits, see alignment E=7.6e-80 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 49 to 302 (254 residues), 229.3 bits, see alignment E=2.7e-72

Best Hits

Swiss-Prot: 57% identical to DCTP_ROSDO: Solute-binding protein RD1_1052 (RD1_1052) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: None (inferred from 97% identity to azl:AZL_e02190)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>MPMX19_06061 Solute-binding protein (Azospirillum sp. SherDot2)
MNSKTPISRRTLAKSIGLGAGIAAGATLLGGIAAPAIVRAQAKTTLKLGHLANEDNVWHK
ASLVFAEEVAKRTNGAVEVKVFPNEQLGKETDLIKGIQLGTIDFTITGESLQNWAPAAAL
LAVPYAIRDLDHLDKVVTGEPGKKIAEAIEQKTQLVPLTYFARGPRNLTSKRPIKSPDEL
NGLKMRVPNVPLFVSFWQGLGAKPTPMAFSEVFTGLQNDTIEAQENPLALIKSASFYEVQ
KYVNQTEHVISWIYLVGGSKKMNKLPAEQRAAIMEAAKAAQAAERKLFIEDEAKLAADLK
AKGMEFIAVDKAAFAEKGRPAVVAALSPEIKPIYDEILAVK