Protein Info for MPMX19_06056 in Azospirillum sp. SherDot2

Annotation: Putrescine transport system permease protein PotH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 280 (188 residues), 35.2 bits, see alignment E=5.4e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to azl:AZL_e02240)

Predicted SEED Role

"ABC transporter, membrane spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MPMX19_06056 Putrescine transport system permease protein PotH (Azospirillum sp. SherDot2)
MSAVLEGRAEGPTLRQRLAARGIDGATLLVLPCVALILGLFIYPFLYGLMLSFEPKDGSL
FGNYARFFSDPFLYGTIFKTLRLAFPVTLLNLLIAIPIAFRVRLMRRQRLLTTLLVLPIT
LGTVLVAEGMLFYFGPQGWFNRALMAVGLLSTPISVLNGYWGVFISLVLTGFPFTFLLTL
SYVTGIDPSLENAAATLGAGPAARFREVFLPLLIPGLAITFCLSFVQAYSVLPSAVLVGD
PAGATRVISIAAYQAAFEEYDYSMASAIAMIMGAVQLLVVVAVLGCRSLFYRGPAAGAKG