Protein Info for MPMX19_06045 in Azospirillum sp. SherDot2

Annotation: putative cyclic di-GMP phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF00072: Response_reg" amino acids 17 to 128 (112 residues), 93.3 bits, see alignment E=1.6e-30 PF13487: HD_5" amino acids 171 to 354 (184 residues), 97.9 bits, see alignment E=8.7e-32 PF01966: HD" amino acids 182 to 322 (141 residues), 61.1 bits, see alignment E=2e-20

Best Hits

Swiss-Prot: 49% identical to CDPD2_PSEAE: Cyclic di-GMP phosphodiesterase PA4781 (PA4781) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07814, putative two-component system response regulator (inferred from 62% identity to cvi:CV_2497)

Predicted SEED Role

"Pole remodelling regulatory diguanylate cyclase" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>MPMX19_06045 putative cyclic di-GMP phosphodiesterase (Azospirillum sp. SherDot2)
MSLPHPVGQPNGDKPRILIVDDEPINLKVMADLLRDSYSLIVAKDGPQALARLAGDPLPD
LILLDVMMPGMDGVEVCRRLKGDARTRGVPVIFITAMGQVHDETRGFEVGAVDYITKPIS
PPVMLARVRTHIALREAQRALADQNRQLEDRVAERTRDLLRAQDATIRAMASLAETRDNE
TGNHIRRTQNYVLALALHLSRDPRYAGQLDEETIELLYKSAPLHDVGKVGIPDSILLKPG
KLSDDEFHVMKTHAALGHDAIFAAEGQADLAIAGGSSFLRIAREIAHGHHERWDGTGYPQ
GLAGEAIPLSARLMAVADVYDALISRRCYKPPFPHEKAASIIREGSGSHFDPAVVAAFNA
LEDEFTDIASRYKDEE