Protein Info for MPMX19_05948 in Azospirillum sp. SherDot2

Annotation: Isoquinoline 1-oxidoreductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 4 to 60 (57 residues), 37.3 bits, E=2.1e-13
• PF01799: Fer2_2
  • amino acids 73 to 145 (73 residues), 98.2 bits, E=2.4e-32

Best Hits

Swiss-Prot: 53% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 70% identity to azc:AZC_0420)

MetaCyc: 53% identical to isoquinoline 1-oxidoreductase subunit alpha (Brevundimonas diminuta)
Isoquinoline 1-oxidoreductase. [EC: 1.3.99.16]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.3.99.16

Protein Sequence (153 amino acids)

>MPMX19_05948 Isoquinoline 1-oxidoreductase subunit alpha (Azospirillum sp. SherDot2)
MVRINVNGEERQVDVPEDMPLLWVLRDELNMTGTKFGCGIAQCGACTVHVDGTPTRACQT
PVGMLTPDSKVTTIEGVKGKAAQAVQAAWQKLDVVQCGYCQSGQIMSAVALLTDNQNPTD
QDIDAAMDGNVCRCATYVRIRAAIKDAAQTMRA