Protein Info for MPMX19_05939 in Azospirillum sp. SherDot2

Annotation: Vitamin B12 transport ATP-binding protein BacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 56 to 77 (22 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 54 to 324 (271 residues), 136.8 bits, see alignment E=9.8e-44 PF05992: SbmA_BacA" amino acids 56 to 367 (312 residues), 84.3 bits, see alignment E=1.1e-27

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 90% identity to azl:AZL_e01420)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (617 amino acids)

>MPMX19_05939 Vitamin B12 transport ATP-binding protein BacA (Azospirillum sp. SherDot2)
MGGMTEDTGGDTGAGEVTGTGTGRGGDDSGGKAPGFARRFLSLAGGYWHGRSRVTVWALT
VALVVLTVGQVSVPVLINLWSERLFDALEQRSMDRFLTMIGLVGLIILYNIVIVVLHLRV
KRRLQMGWRDWLTRKLLEDWLRRGRHHQIAYMPGEHDNPDGRIAEDIRITAEMAIDLGHS
LTYCALLLISFTNILWMLSGTLSVTLLGMELAVPGHLLFVALLYAAVGTTIAMLIGQPLV
NAVNRRQGYEADFRFALARIRENGQTIALLHGESAERGHLSGLFGGVVRGWNRQTRALSH
MMVFSASYSVLSTAFPVLVAAPRYIAGTITLGVLMQTAQAFQQTVGALSWPIDNLPRVAE
WRASVERVLNLHDALVRLDRNVCEVPDAHIQLVRSDEHDRLTFRGVAIDEPNGTAVVHPF
DLEVRPGDRVLIGGDATATIRLFRAVAGVWPWGRGLITLPAHTRVFFMPERPYLPHASLR
AVLAYPGTASSVGDDKAAGALVSVGLPDLVGRLDSIDHWDEVLSVPERQRLGFARLLIRR
PDWIFLEDATDSLDPPAEEELLSLMERELPHATLLTIGHHAGLAAHHGRKLVLERTNGAV
TLREEARPIRPVEESAA