Protein Info for MPMX19_05872 in Azospirillum sp. SherDot2

Annotation: Redox-sensitive transcriptional activator SoxR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR01950: redox-sensitive transcriptional activator SoxR" amino acids 11 to 149 (139 residues), 226.3 bits, see alignment E=5.5e-72 PF00376: MerR" amino acids 12 to 48 (37 residues), 50.2 bits, see alignment E=4.4e-17 PF13411: MerR_1" amino acids 12 to 78 (67 residues), 53.6 bits, see alignment E=4.9e-18 PF09278: MerR-DNA-bind" amino acids 53 to 118 (66 residues), 71.4 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 65% identical to SOXR_SALTI: Redox-sensitive transcriptional activator SoxR (soxR) from Salmonella typhi

KEGG orthology group: K13639, MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR (inferred from 94% identity to azl:AZL_e00030)

Predicted SEED Role

"Redox-sensitive transcriptional activator SoxR" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>MPMX19_05872 Redox-sensitive transcriptional activator SoxR (Azospirillum sp. SherDot2)
MLSPEEYDKDLTVGEVARRSGVAVSTIHFYEAQGLIRSWRNPGNQRRFSRDVLRRVAVVK
VAQRLGISLASIADALNALPEDRTPTTADWRRMSERWREELDDRIAKLTKLRDNLDGCIG
CGCLSIRDCPLRNPWDELGDGGAGPRLLDPA