Protein Info for MPMX19_05869 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01313: carbohydrate kinase, thermoresistant glucokinase family
  • amino acids 27 to 183 (157 residues), 191.4 bits, E=4.8e-61
• PF13671: AAA_33
  • amino acids 27 to 157 (131 residues), 32 bits, E=1.5e-11
• PF01202: SKI
  • amino acids 34 to 141 (108 residues), 28.8 bits, E=1.2e-10

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 75% identity to azl:AZL_d00380)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

• L-idonate degradation (3/3 steps found)
• sorbitol biosynthesis II (3/3 steps found)
• D-gluconate degradation (1/1 steps found)
• ketogluconate metabolism (4/8 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.12

Use Curated BLAST to search for 2.7.1.12

Protein Sequence (205 amino acids)

>MPMX19_05869 hypothetical protein (Azospirillum sp. SherDot2)
MNGPPIAPSPGMNAIPPELSGGAPLIVVVMGVAGCGKSSVGQSLAAKLGDEFIEGDAHHP
PANIEKMSAGIPLTDADRDGWLATLAGFIAEAHRAERGLVVACSALKRRYRDRLRGDCER
VVFLHLHGDKALISSRMGARTAHFMPTALVDSQFADLEMPTADEVVLSYEVTLPAEAIVA
DACARLTGARKTGDWKTGEKSGRNA