Protein Info for MPMX19_05794 in Azospirillum sp. SherDot2

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details PF00892: EamA" amino acids 44 to 176 (133 residues), 60.8 bits, see alignment E=8.9e-21 amino acids 187 to 310 (124 residues), 50.6 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: None (inferred from 85% identity to azl:AZL_d01350)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>MPMX19_05794 Riboflavin transporter (Azospirillum sp. SherDot2)
MPDSSTSRTNAETGPEPVNAPQTPIQPTVNPQAGSGSKGTEPMRAILLVVLGVACLSCSD
ATAKYLGRTLPPAEIAWMRYVVFTALVMPLALRGGSLSVLKTTRPGLQVVRGLGMLGSAL
FFIMAMQHLPLAEAAAISFVSPVFVTVLSILLLAEKVGVRRWAALLVGLAGVIIVIRPGA
DGFQPASLLPILTAFSWALGLVATRRMTVQENPLTTMVWSALTGLIALTALLPLHAAWPT
PWEMLLGAFIGLVYTLAQWLLILAYRQGEASVLAPFTYVQLIWSTALGFLVFGAVPDHWT
FVGTGVIIASGLYTAHRERMRARERRSIGH