Protein Info for MPMX19_05788 in Azospirillum sp. SherDot2

Annotation: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF04962: KduI" amino acids 38 to 270 (233 residues), 116.2 bits, see alignment E=8.5e-38

Best Hits

Swiss-Prot: 56% identical to KDUI_CALBD: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (kduI) from Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320)

KEGG orthology group: K01815, 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC: 5.3.1.17] (inferred from 95% identity to azl:AZL_d01450)

MetaCyc: 55% identical to 5-dehydro-4-deoxy-D-glucuronate isomerase (Escherichia coli K-12 substr. MG1655)
Glucose-6-phosphate isomerase. [EC: 5.3.1.9]; 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase. [EC: 5.3.1.9, 5.3.1.17]

Predicted SEED Role

"4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 5.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.9

Use Curated BLAST to search for 5.3.1.17 or 5.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MPMX19_05788 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (Azospirillum sp. SherDot2)
MKISVRHASHPDAVRGFDTETLRDHFLVPTLFEADETVFTYSHIDRFVVGGAMPVAGPVK
LESSKEIGSPNFLDRRELGVVNVGGAGRVTVDGAVYELAPRDALYVAMGSKDVVFESLDR
REPAKFYLNSTPAHARFETMKISIGQAKAVHLGDPAQSNERTIYQMIHPDVVRTAQLVLG
MTVLKPNNMWNTMPCHTHDRRCEVYFYFDLPEEARVVHLMGEPEQTRHIVVANEQAVISP
PWSIHSGVGTRNYTFIWAMGGDNQDFTDMDFVAMDRLR