Protein Info for MPMX19_05777 in Azospirillum sp. SherDot2

Annotation: 3-hydroxyadipyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02279: 3-hydroxyacyl-CoA dehydrogenase PaaC" amino acids 4 to 501 (498 residues), 723 bits, see alignment E=1.1e-221 PF03446: NAD_binding_2" amino acids 9 to 55 (47 residues), 22 bits, see alignment 3e-08 PF02737: 3HCDH_N" amino acids 9 to 186 (178 residues), 205.3 bits, see alignment E=1.5e-64 PF00725: 3HCDH" amino acids 190 to 286 (97 residues), 104.7 bits, see alignment E=6e-34 amino acids 417 to 498 (82 residues), 60.5 bits, see alignment E=3.8e-20 PF18321: 3HCDH_RFF" amino acids 347 to 416 (70 residues), 90.7 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 89% identity to azl:AZL_d01550)

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase PaaC (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.157

Use Curated BLAST to search for 1.1.1.- or 1.1.1.157

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>MPMX19_05777 3-hydroxyadipyl-CoA dehydrogenase (Azospirillum sp. SherDot2)
MAALAPSVTVAVVGAGAMGQGIAQVAAQAGHPVLLVDTRPGAAQAAVGSIAKALTALVEK
GKRTAAERDAAMDRLRAVDGLSDLAPARLVVEAIVEDLDVKRRLFAELEGIVGAGAILAT
NTSSLSVTAIGAGVRRPERLAGLHFFNPAPLMALVEIVSGLATDTAVLDTLFDTAKAWGK
SPVRCRSTPGFIVNRVARPFYAEGLRLVQEQAADPATVDAVAREAGSFRMGPFELMDLIG
HDVNFAVTRSVHAAYFGDPRFQPSLIQQELVEAGRLGRKTGRGFYDHGPGAAKPAPHTAE
PAAKPDRVLVQGDLGPAASLVGLLREAGIAVEETAGSGLLVADGVTLALTDGRTATARAA
EDGIAPLVLFDLALDYAKATRVALAPADGTPPEALAVAAGLFQALGKAVSVIDDAPGLVV
MRTVAMLASEAADAAMQGVASAADIDIAMTKGVNYPLGPLAWADRIGLPHVLAVLDALAR
TYGEDRYRASALLRRKISGGNRFHG