Protein Info for MPMX19_05725 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 97 to 412 (316 residues), 292.2 bits, see alignment E=2.4e-91 PF00595: PDZ" amino acids 136 to 207 (72 residues), 37 bits, see alignment E=7.5e-13 PF13180: PDZ_2" amino acids 138 to 210 (73 residues), 38.6 bits, see alignment E=2.2e-13 PF17820: PDZ_6" amino acids 155 to 209 (55 residues), 44.1 bits, see alignment 2.8e-15 PF03572: Peptidase_S41" amino acids 238 to 404 (167 residues), 159.6 bits, see alignment E=1.1e-50

Best Hits

KEGG orthology group: None (inferred from 96% identity to azl:AZL_d02000)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>MPMX19_05725 hypothetical protein (Azospirillum sp. SherDot2)
MAKLLAALLLMMVAIGPACAVAPTSRADTVAALDRYRTDFAKIRGYGSLSTADRNYVLFS
DAMRRVLTEHVKPFDPQVLIDKAEDGLKKKKAENPKASDRLLTEAALDSMLGSLDPYSSF
LDAERYRYLREQTQGEFGGLGIEVTMDEESGLIKVVSPIDGSPAARAGLRSGDLIARIDD
VAVKGLNLHDAVARMRGPVGSSVALSIRRPPATDANTRVSLTRAIVKIQPVRYRLEGNVA
YVRIATFNQSTSSALDAAIEDMRRQSKGRLTGAVIDLRNNPGGLLEQAVQVADRFLETVD
IVSVRGRDPEESRTYRGTAGDLMAGLPVVVLINSGSASASEIVAGALQDHHRALLFGSRS
YGKGSVQTISSLSADTGIRLTTARYYRPSGALVDCFGVSPNLEVKPTHGSTEETHPDPAT
CDPNAPVPPKPQVWMAPDMCPDVMDKAPKPDDDRPLECAVSAIRNRLTGTLAGGE