Protein Info for MPMX19_05654 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 160 to 185 (26 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details PF09335: SNARE_assoc" amino acids 54 to 185 (132 residues), 79 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 40% identical to APL_LACLM: Alkaline phosphatase-like protein (apl) from Lactococcus lactis subsp. cremoris (strain MG1363)

KEGG orthology group: None (inferred from 58% identity to mex:Mext_0105)

Predicted SEED Role

"DedA family; putative alkaline phosphatase-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>MPMX19_05654 hypothetical protein (Azospirillum sp. SherDot2)
MQPIAPSRCCSGGGWRVGRREEKTVFDWIVGMVEQTGYLGVALLMFAENLFPPIPSELIL
PLAGFTAARGDLGLPMIIVSGTVGAVLGALFWYGIGRWVGSRRLKQWAARHGRWLTIAPE
EVDEAAAHFREHGGRAVLIGRMIPAVRTLISIPAGVSNMALVPFLLYTTAGTAIWTTFLA
SAGYLLEDRYQQIAGWLNPVSNIVAAGIALWYVYRVATFGRRSARQPAE