Protein Info for MPMX19_05625 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 450 to 469 (20 residues), see Phobius details PF02706: Wzz" amino acids 22 to 105 (84 residues), 56.5 bits, see alignment E=5.6e-19 PF13807: GNVR" amino acids 390 to 471 (82 residues), 49.2 bits, see alignment E=8.4e-17 PF13614: AAA_31" amino acids 538 to 696 (159 residues), 35.6 bits, see alignment E=1.9e-12 PF01656: CbiA" amino acids 548 to 717 (170 residues), 25.7 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_d02550)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (734 amino acids)

>MPMX19_05625 hypothetical protein (Azospirillum sp. SherDot2)
MSPGISYDLSASAASAVRRTTGLLRRHKLLIGTVIVVGTGLAALVAFRMTPLYTAETLIM
VEHRKNTVLNFEGVVSDMTPDISALQSEVAILKSPAFAEKVVAKLKLMNDPEFNASLRPP
PPGWVSALNPRNWIPDSWKASSGVPLSPEEIERNHLTSVVNAVLDNTSVRPQGRSYVIAV
SFDSEDPRKSSLIANTMADLYLVDQLDEKFKASKRATQWLEERLTDLRREAQTTGDAVEK
YRTQHGLTTSSNNESTVVGQQLSQLNADYILARTKRQEAETKLRDVTAMANSPRGASAVG
DVMGSPLIQALREREVDLQRQIADATNRYGAKHPMLQALQSQLRDLQGQIKTDVGKIVSN
LSNEVELAKGREQGLKASLDQAEAKQNEQQQATVGLRTLERDAGTAQSMYEALLTRSQQI
ATQNDMRQPDARIVSEASIPLDPSQPNRKLILLLALVASGTLGVLLAMLRERAESGFRSP
HQFETATGVRSLGIVPRIPRFGGSPAAYVVDKPISAFAESMQNLRTSLLLANPDGRHRVI
LFSSSVPGEGKSSVAAAFARTCANAGQRTILVDCDLRRKCLHEMLGMSNNRGLAEVLAGT
ATLEEVIQVDPRTGLHVIPAGHGRTLPQDTLGSSGMHQLLSRLSVNYDRIVLDSPPVLAV
SEGKLLAALADQTVFIVRWGMTKRGTAMAGLKEVIEAGGEVVGVLFSQVDTRRHAQYEFP
DSGRYHGYRRYYAN