Protein Info for MPMX19_05619 in Azospirillum sp. SherDot2

Annotation: Aminopyrimidine aminohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 49 to 67 (19 residues), see Phobius details PF03070: TENA_THI-4" amino acids 18 to 224 (207 residues), 162.4 bits, see alignment E=6.7e-52 TIGR04306: thiaminase II" amino acids 19 to 225 (207 residues), 147.7 bits, see alignment E=1.9e-47

Best Hits

Swiss-Prot: 40% identical to Y358_HAEIN: Uncharacterized protein HI_0358 (HI_0358) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03707, thiaminase (transcriptional activator TenA) [EC: 3.5.99.2] (inferred from 93% identity to azl:AZL_d02610)

Predicted SEED Role

"Thiaminase II (EC 3.5.99.2) involved in salvage of thiamin pyrimidine moiety" (EC 3.5.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>MPMX19_05619 Aminopyrimidine aminohydrolase (Azospirillum sp. SherDot2)
MTPSSSTPDLFNRLVAGARPDWSAYVDHAFVRGMGDGTLPQECFRHYLVQDYLFLIHFAR
AYALAIYKGRDLREMRASLNGLKAILDMEMDLHVGLCAGWGLPAAELEQAAESKATMAYT
RYVLETGLRGDLLDLHVALSPCIIGYAEIGRRLAALPGALDDANPYRVWIAEYAGDAYQE
VARAARENLDRLAADGMTEARFPRLLTIFRQASRLEADFWEMGMTLAG