Protein Info for MPMX19_05562 in Azospirillum sp. SherDot2

Annotation: Hydrogenobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 5 to 433 (429 residues), 323.8 bits, E=9.4e-101
• PF01656: CbiA
  • amino acids 5 to 192 (188 residues), 56.8 bits, E=3.5e-19
• PF07685: GATase_3
  • amino acids 247 to 435 (189 residues), 109.8 bits, E=2e-35

Best Hits

Swiss-Prot: 56% identical to COBB_RHILO: Hydrogenobyrinate a,c-diamide synthase (cobB) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 92% identity to azl:AZL_d03390)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (32/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (30/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (12/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Protein Sequence (437 amino acids)

>MPMX19_05562 Hydrogenobyrinate a,c-diamide synthase (Azospirillum sp. SherDot2)
MTKGIIIAAPASGTGKTTLTLGLLAALRARGVAVGAVKSGPDYIDPAFHRAATGRPSVNL
DTWAMGPDLLDGLAARAAEGADLLVCEALMGLFDGVAGVGATGTGSTAEIAARTGWPVLL
VVNAKGQSQSAAALVKGFATYRDDVTIGGVVLNNVGSLRHTSLAGTAIEALGIPLLGALP
RAPDLSLPERHLGLVQADETEGLSDRLAALGRFIAGHVDLDRVVALAKPSQAGRGSDAPA
LPPPGQRIAIAQDAAFTFVYPHLTAGWQAAGAELRFFSPLADEAPPLDSDAVYLPGGYPE
LHAGRLAANHVFRDGLRAAAERVPVYGECGGYMVMGETLEDADGVTHKMTGLLGVRTSFA
KRRLHLGYRRASLLADGPLGAAGTPLMGHEFHYASTLSRGDDAPLLQATAADGSDLGALG
SRRGLALGSFVHLIARG