Protein Info for MPMX19_05531 in Azospirillum sp. SherDot2

Annotation: Serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF06426: SATase_N" amino acids 19 to 122 (104 residues), 110.6 bits, see alignment E=4.6e-36 TIGR01172: serine O-acetyltransferase" amino acids 92 to 252 (161 residues), 230.9 bits, see alignment E=3.9e-73 PF00132: Hexapep" amino acids 203 to 237 (35 residues), 29.4 bits, see alignment 4.7e-11

Best Hits

Swiss-Prot: 53% identical to CYSE_ECOLI: Serine acetyltransferase (cysE) from Escherichia coli (strain K12)

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 96% identity to azl:AZL_d01020)

MetaCyc: 53% identical to serine acetyltransferase (Escherichia coli K-12 substr. MG1655)
Serine O-acetyltransferase. [EC: 2.3.1.30]

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MPMX19_05531 Serine acetyltransferase (Azospirillum sp. SherDot2)
MDSLDVTMREPAETVEQSLWRRLRADAVRVAEEESGLAPFLYDAVLARDGFGPALAALLV
RKLADRAMPEDRLAAVVRDAMEADPAIVEAAAADLAAILARDPAADGCLTPFLYFKGYHA
LQWHRVAHWLWRAGRHDLAHFLQSRVSEAFAVDIHPAVPVGRGVFIDHGTGVVIGETAVI
GNDVSILQNVTLGGTGKEHGDRHPKVRDGVLLSAGAKVLGNITIGAHAKVGAGSVVLKDV
PGCATVAGVPAKVVGWCRDEPAPALTMDQSLQQGDYSI